PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g024690.1
Common NameMTR_8g024690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 354aa    MW: 39316.8 Da    PI: 9.4993
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g024690.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding262.1e-08205234130
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIart 30 
                      r+ W++eEd +l  av++ G g+W t a+ 
  Medtr8g024690.1 205 RKEWSEEEDNQLRAAVQRCGEGNWVTMAKG 234
                      789***********************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.443200258IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-11201257IPR009057Homeodomain-like
SuperFamilySSF466893.66E-10203256IPR009057Homeodomain-like
SMARTSM007176.0E-9204256IPR001005SANT/Myb domain
PfamPF002491.1E-6205250IPR001005SANT/Myb domain
CDDcd116602.86E-10206255No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MPENNPKKKV TFSENDAASI TQRYDTKTLL TLFQELSNYP DTKFDWNELV NKTSTGISNA  60
REYQMLWRCL AYGYSLPLPQ DFKQGGGEPM DDDSDLDCEL ESFPSVHVEA KSESSACAKV  120
IIASRTLSES TPNSSTIEAP MTVNFPIYRS SRTSKEISQP SNLTEQTSIT FPVTVQRQKL  180
RTVSATDALE TKRTVGGTTA SKRKRKEWSE EEDNQLRAAV QRCGEGNWVT MAKGDSFPIK  240
RSATELSQRW SALRKKDGSA NSGSTATTVT TNTQYTAEQL ATRRSLSLAL DKPFKKFTAP  300
GRTDPGRTST PIKNQEHSRS SVAPQRPSQQ ACGPLRNRNW PVKHASPHME ANF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.22140.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU1376401e-116CU137640.12 M.truncatula DNA sequence from clone MTH2-50D4 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013444572.10.0myb-like DNA-binding domain protein
TrEMBLA0A072TMF00.0A0A072TMF0_MEDTR; Myb-like DNA-binding domain protein
STRINGGLYMA04G10185.11e-141(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF31223256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09710.15e-49MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]